- hnRNP U Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP2-48729
- 0.1 ml (also 25ul)
- Immunohistochemistry, Immunohistochemistry-Paraffin
- Unconjugated
- PBS (pH 7.2) and 40% Glycerol
- Human
- hnRNP U
- IgG
- Rabbit
- This antibody was developed against a recombinant protein corresponding to amino acids: TEQKGGDKKR GVKRPREDHG RGYFEYIEEN KYSRAKSPQP PVEEEDEHFD DTVVCLDT
- heterogeneous nuclear ribonucleoprotein U
- DEE54, EIEE54, GRIP120, HNRNPU-AS1, HNRPU, SAF-A, SAFA, U21.1, hnRNP U, pp120
- Polyclonal
- Immunogen affinity purified
- Novus Biologicals, a Bio-Techne Brand
- Cellular Markers
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
TEQKGGDKKRGVKRPREDHGRGYFEYIEENKYSRAKSPQPPVEEEDEHFDDTVVCLDT
Specifications/Features
Available conjugates: Unconjugated